MBS658397 | HIV-2 gp41 Antigenic Peptide 5

(No reviews yet) Write a Review
SKU:
MBS658397
Availability:
Usually Shipped in 5 Working Days
Size:
1 mg
£1,185.60
Frequently bought together:

Description

HIV-2 gp41 Antigenic Peptide 5 | MBS658397 | MyBiosource

Product Short Name: [HIV-2 gp41 Antigenic Peptide 5]

Product Name Synonyme: [HIV-2 gp41 Antigenic Peptide 5 (RVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDS-NH2)]

Other Names: N/A

Product Gene Name: N/A

Product Gene Name Synonyme: N/A

Other Gene Names: N/A

Clonality: N/A

Isotype: N/A

Clone: N/A

Host: Synthetic peptide

Reactivity: Human

Specificity: N/A

Purity: Highly Purified
~95%. Purified by HPLC.

Form: Supplied as a lyophilized powder.

Concentration: N/A

Storage Stability: Lyophilized powder may be stored at 4 degree C for short-term only. Stable for 12 months at -20 degree C. Reconstitute to nominal volume (see reconstitution instructions for peptides) and store at -20 degree C. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.

Tested Application: N/A

View AllClose