MyBiosource Peptides
MBS658397 | HIV-2 gp41 Antigenic Peptide 5
- SKU:
- MBS658397
- Availability:
- Usually Shipped in 5 Working Days
- Size:
- 1 mg
Description
HIV-2 gp41 Antigenic Peptide 5 | MBS658397 | MyBiosource
Product Short Name: [HIV-2 gp41 Antigenic Peptide 5]
Product Name Synonyme: [HIV-2 gp41 Antigenic Peptide 5 (RVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDS-NH2)]
Other Names: N/A
Product Gene Name: N/A
Product Gene Name Synonyme: N/A
Other Gene Names: N/A
Clonality: N/A
Isotype: N/A
Clone: N/A
Host: Synthetic peptide
Reactivity: Human
Specificity: N/A
Purity: Highly Purified
~95%. Purified by HPLC.
Form: Supplied as a lyophilized powder.
Concentration: N/A
Storage Stability: Lyophilized powder may be stored at 4 degree C for short-term only. Stable for 12 months at -20 degree C. Reconstitute to nominal volume (see reconstitution instructions for peptides) and store at -20 degree C. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.
Tested Application: N/A