MyBiosource Peptides
MBS318035 | Beta-Defensin-1 (a.a. 1-36) Peptide
- SKU:
- MBS318035
- Availability:
- Usually Shipped in 5 Working Days
- Size:
- 0.1 mg
Description
Beta-Defensin-1 (a.a. 1-36) Peptide | MBS318035 | MyBiosource
Product Short Name: [Defensin, beta-1 (a.a. 1-36), Human]
Product Name Synonyme: [Human beta-Defensin 1 (amino acids 1-36) Peptide]
Other Names: [Defensin, beta 1; Beta-defensin 1; beta-defensin 1; BD-1; beta-defensin-1; OTTHUMP00000159500; defensin, beta 1; Defensin, beta 1]
Product Gene Name: N/A
Product Gene Name Synonyme: N/A
Other Gene Names: [DEFB1; DEFB1; BD1; HBD1; DEFB-1; DEFB101; MGC51822; BD1; HBD1]
Clonality: N/A
Isotype: N/A
Clone: N/A
Host: Synthetic human beta-Defensin 1 peptide (a.a. 1-36) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK)
Reactivity: N/A
Specificity: Defensin, beta-1 (a.a. 1-36), Human
Purity: >95% pure (HPLC)
Form: Purified, Lyophilized.
Reconstitute in 0.1% acetic acid for required concentration.
Concentration: N/A
Storage Stability: Store at -20 degree C.
Tested Application: EIA/ELISA, Western Blot
Related Products
MBS584761 | Alpha-1-antitrypsin, Human, mAb 2C1
MyBiosource Antibodies
MBS2101745 | Gastrin Releasing Peptide (GRP) Antibody Pair Kit (with Standard)
MyBiosource
MBS2101747 | Gastrin Releasing Peptide Receptor (GRPR) Antibody Pair Kit (with Standard)
MyBiosource
MBS2117442 | APC-Cy7 Linked Polyclonal Antibody to Gastrin Releasing Peptide (GRP)
MyBiosource Antibodies
MBS1492173 | Rabbit anti-human Gastrin-releasing peptide polyclonal Antibody, FITC
MyBiosource Antibodies
MBS2121617 | Cy3-Linked Polyclonal Antibody to Gastrin Releasing Peptide (GRP)
MyBiosource Antibodies