MBS318034 | Beta-Defensin-2 (a.a. 4-41) Peptide

Beta-Defensin-2 (a.a. 4-41) Peptide | MBS318034 | MyBiosource

Product Short Name: [Defensin, beta-2 (a.a. 4-41), Human]

Product Name Synonyme: [Human beta-Defensin 2 (amino acids 4-41) Peptide]

Other Names: [Defensin beta 2; Beta-defensin 2; beta-defensin 2; OTTMUSP00000022725; defensin beta 2; Defensin, beta 2]

Product Gene Name: N/A

Product Gene Name Synonyme: N/A

Other Gene Names: [Defb2; Defb2; BD-2; MGC129140; MGC129141]

Clonality: N/A

Isotype: N/A

Clone: N/A

Host: Synthetic human beta-Defensin 2 peptide (a.a. 4-41) , (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)

Reactivity: N/A

Specificity: Defensin, beta-2 (a.a. 4-41), Human

Purity: >95% pure (HPLC)

Form: Purified, Lyophilized, Reconstitute in 0.1% acetic acid for required concentration.

Concentration: N/A

Storage Stability: Store lyophilized product at 2 to 8 degree C. After reconstitution, aliquot and store at -20 degree C. Avoid multiple freeze/thaw cycles.

Tested Application: EIA/ELISA